Recombinant Full Length Human GNG11 Protein, GST-tagged
| Cat.No. : | GNG11-5385HF |
| Product Overview : | Human GNG11 full-length ORF ( AAH09709, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 73 amino acids |
| Description : | This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq |
| Molecular Mass : | 33.77 kDa |
| AA Sequence : | MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GNG11 guanine nucleotide binding protein (G protein), gamma 11 [ Homo sapiens ] |
| Official Symbol | GNG11 |
| Synonyms | GNG11; guanine nucleotide binding protein (G protein), gamma 11; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11; G protein gamma 11 subunit; GNGT11; guanine nucleotide binding protein G(I)/G(S)/G(O) gamma 11 subunit; G protein gamma-11 subunit; guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit; |
| Gene ID | 2791 |
| mRNA Refseq | NM_004126 |
| Protein Refseq | NP_004117 |
| MIM | 604390 |
| UniProt ID | P61952 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNG11 Products
Required fields are marked with *
My Review for All GNG11 Products
Required fields are marked with *




