Recombinant Full Length Human GNS Protein, GST-tagged
Cat.No. : | GNS-5414HF |
Product Overview : | Human GNS full-length ORF ( NP_002067.1, 1 a.a. - 552 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 552 amino acids |
Description : | The product of this gene is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparan sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder mucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome. [provided by RefSeq |
Molecular Mass : | 88.5 kDa |
AA Sequence : | MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNS glucosamine (N-acetyl)-6-sulfatase [ Homo sapiens ] |
Official Symbol | GNS |
Synonyms | GNS; glucosamine (N-acetyl)-6-sulfatase; N-acetylglucosamine-6-sulfatase; N acetylglucosamine 6 sulfatase; Sanfilippo disease IIID; glucosamine-6-sulfatase; G6S; MGC21274; |
Gene ID | 2799 |
mRNA Refseq | NM_002076 |
Protein Refseq | NP_002067 |
MIM | 607664 |
UniProt ID | P15586 |
◆ Recombinant Proteins | ||
GNS-5414HF | Recombinant Full Length Human GNS Protein, GST-tagged | +Inquiry |
GNS-7057M | Recombinant Mouse GNS Protein | +Inquiry |
GNS-805H | Recombinant Human GNS Protein, His-tagged | +Inquiry |
GNS-3789M | Recombinant Mouse GNS Protein, His (Fc)-Avi-tagged | +Inquiry |
Gns-3267M | Recombinant Mouse Gns Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNS-5836HCL | Recombinant Human GNS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNS Products
Required fields are marked with *
My Review for All GNS Products
Required fields are marked with *
0
Inquiry Basket