Recombinant Full Length Human GOLPH3 Protein
Cat.No. : | GOLPH3-201HF |
Product Overview : | Recombinant full length Human GOLPH3 with proprietary tag; Predicted MWt 58.85 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 298 amino acids |
Description : | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. |
Form : | Liquid |
Molecular Mass : | 58.850kDa inclusive of tags |
AA Sequence : | MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GOLPH3 golgi phosphoprotein 3 (coat-protein) [ Homo sapiens ] |
Official Symbol | GOLPH3 |
Synonyms | GOLPH3; golgi phosphoprotein 3 (coat-protein); Golgi phosphoprotein 3; coat protein; golgi peripheral membrane protein 1; 34 kDa; golgi protein; golgi associated protein; GOPP1; GPP34; MIDAS |
Gene ID | 64083 |
mRNA Refseq | NM_022130 |
Protein Refseq | NP_071413 |
MIM | 612207 |
UniProt ID | Q9H4A6 |
◆ Recombinant Proteins | ||
GOLPH3-7068M | Recombinant Mouse GOLPH3 Protein | +Inquiry |
GOLPH3-2051H | Recombinant Human GOLPH3 Protein, MYC/DDK-tagged | +Inquiry |
GOLPH3-5449HF | Recombinant Full Length Human GOLPH3 Protein, GST-tagged | +Inquiry |
Golph3-3270M | Recombinant Mouse Golph3 Protein, Myc/DDK-tagged | +Inquiry |
GOLPH3-3796M | Recombinant Mouse GOLPH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOLPH3-728HCL | Recombinant Human GOLPH3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOLPH3 Products
Required fields are marked with *
My Review for All GOLPH3 Products
Required fields are marked with *