Recombinant Full Length Human GOLPH3 Protein

Cat.No. : GOLPH3-201HF
Product Overview : Recombinant full length Human GOLPH3 with proprietary tag; Predicted MWt 58.85 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 298 amino acids
Description : The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.
Form : Liquid
Molecular Mass : 58.850kDa inclusive of tags
AA Sequence : MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name GOLPH3 golgi phosphoprotein 3 (coat-protein) [ Homo sapiens ]
Official Symbol GOLPH3
Synonyms GOLPH3; golgi phosphoprotein 3 (coat-protein); Golgi phosphoprotein 3; coat protein; golgi peripheral membrane protein 1; 34 kDa; golgi protein; golgi associated protein; GOPP1; GPP34; MIDAS
Gene ID 64083
mRNA Refseq NM_022130
Protein Refseq NP_071413
MIM 612207
UniProt ID Q9H4A6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GOLPH3 Products

Required fields are marked with *

My Review for All GOLPH3 Products

Required fields are marked with *

0
cart-icon
0
compare icon