Recombinant Full Length Human GOT2 Protein, GST-tagged

Cat.No. : GOT2-5446HF
Product Overview : Human GOT2 full-length ORF ( AAH00525.1, 1 a.a. - 430 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 430 amino acids
Description : Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq
Molecular Mass : 73.9 kDa
AA Sequence : MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQATK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GOT2 glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) [ Homo sapiens ]
Official Symbol GOT2
Synonyms GOT2; glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2); aspartate aminotransferase, mitochondrial; KAT4; KATIV; kynurenine aminotransferase IV; mitAAT; FABP-1; FABPpm; mAspAT; transaminase A; fatty acid-binding protein; glutamate oxaloacetate transaminase 2; plasma membrane-associated fatty acid-binding protein; FLJ40994;
Gene ID 2806
mRNA Refseq NM_002080
Protein Refseq NP_002071
MIM 138150
UniProt ID P00505

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GOT2 Products

Required fields are marked with *

My Review for All GOT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon