| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-430aa |
| Description : |
Enables L-aspartate:2-oxoglutarate aminotransferase activity. Acts upstream of or within dicarboxylic acid metabolic process. Located in mitochondrion. Is expressed in several structures, including alimentary system; nervous system; respiratory system; sensory organ; and urinary system. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 82. Orthologous to human GOT2 (glutamic-oxaloacetic transaminase 2). |
| Tag : |
N-His |
| Form : |
Liquid |
| Bio-activity : |
Specific activity is > 20 unit/mg, and is defined as the amount of enzyme that converts 1umole of alpha-ketoglutarate to L-Glutamate per minute at pH 8.0 at 25 centigrade. |
| Molecular Mass : |
46.8 kDa (422aa) confirmed by MALDI-TOF |
| AA Sequence : |
SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 90% by SDS-PAGE |
| Applications : |
SDS-PAGE, Enzyme Activity |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Concentration : |
0.5 mg/mL (determined by Bradford assay) |
| References : |
1. Honorat JA., et al. (2017) PLoS One. 12(11):e0187215. 2. Han Q., et al. (2010) BMC Biochemistry. 11:19. |