Recombinant Full Length Human GPATCH3 Protein, GST-tagged
Cat.No. : | GPATCH3-5495HF |
Product Overview : | Human GPATCH3 full-length ORF ( AAH07767.1, 1 a.a. - 525 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 525 amino acids |
Description : | GPATCH3 (G-Patch Domain Containing 3) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding. |
Molecular Mass : | 85.7 kDa |
AA Sequence : | MAVPGEAEEEATVYLVVSGIPSVLRSAHLRSYFSQFREERGGGFLCFHYRHRPERAPPQAAPNSALIPTDPAAEGQLLSQTSATDVRPLSTRDSTPIQTRTCCCVISVRGLAQAQRLIRMYSGRRWLDSHGTWLPGRCLIRRLRLPTEASGLGSFPFKTRKELQSWKAENEAFTLADLKQLPELNPPVLMPRGNVGTPLRVFLELIRACRLPPRIITQLQLQFPKTGSSRRYGNVPFEYEDSETVEQEELVYTAEGEEIPQGTYLADIPASPCGEPEEEVGKEEEEESHSDEDDDRGEEWERHEALHEDVTGQERTTEQLFEEEIELKWEKGGSGLVFYTDAQFWQEEEGDFDEQTADDWDVDMSVYYDRDGGDKDARDSVQMRLEQRLRDGQEDGSVIERQVGTFERHTKGIGRKVMERQGWAEGQGLGCRCSGVPEALDSDGQHPRCKRGLGYHGEKLQPFGQLKRPRRNGLGLISTIYDEPLPQDQTESLLRRQPPTSMKFRTDMAFVRGSSCASDSPSLPD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPATCH3 G patch domain containing 3 [ Homo sapiens ] |
Official Symbol | GPATCH3 |
Synonyms | GPATCH3; G patch domain containing 3; GPATC3; G patch domain-containing protein 3; FLJ12455; DKFZp686E0221; |
Gene ID | 63906 |
mRNA Refseq | NM_022078 |
Protein Refseq | NP_071361 |
MIM | 617486 |
UniProt ID | Q96I76 |
◆ Recombinant Proteins | ||
GPATCH3-5141H | Recombinant Human GPATCH3 Protein, GST-tagged | +Inquiry |
GPATCH3-4622H | Recombinant Human GPATCH3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPATCH3-5119Z | Recombinant Zebrafish GPATCH3 | +Inquiry |
GPATCH3-3817M | Recombinant Mouse GPATCH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gpatch3-3282M | Recombinant Mouse Gpatch3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPATCH3-5817HCL | Recombinant Human GPATCH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPATCH3 Products
Required fields are marked with *
My Review for All GPATCH3 Products
Required fields are marked with *