Recombinant Full Length Human GPR15 Protein
| Cat.No. : | GPR15-5643HF |
| Product Overview : | Human GPR15 full-length ORF (NP_005281.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 225 amino acids |
| Description : | This gene encodes a G protein-coupled receptor that acts as a chemokine receptor for human immunodeficiency virus type 1 and 2. The encoded protein localizes to the cell membrane. [provided by RefSeq, Nov 2012] |
| Form : | Liquid |
| Molecular Mass : | 40.8 kDa |
| AA Sequence : | MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GPR15 G protein-coupled receptor 15 [ Homo sapiens ] |
| Official Symbol | GPR15 |
| Synonyms | GPR15; G protein-coupled receptor 15; G-protein coupled receptor 15; BOB; brother of Bonzo; MGC126828; MGC126830; |
| Gene ID | 2838 |
| mRNA Refseq | NM_005290 |
| Protein Refseq | NP_005281 |
| MIM | 601166 |
| UniProt ID | P49685 |
| ◆ Recombinant Proteins | ||
| GPR15-7151M | Recombinant Mouse GPR15 Protein | +Inquiry |
| EIF1B-3480H | Recombinant Human EIF1B, His-tagged | +Inquiry |
| RFL15596MF | Recombinant Full Length Macaca Fascicularis G-Protein Coupled Receptor 15(Gpr15) Protein, His-Tagged | +Inquiry |
| EIF1B-5654H | Recombinant Human EIF1B protein | +Inquiry |
| RFL28467MF | Recombinant Full Length Macaca Mulatta (Rhesus Macaque) G-Protein Coupled Receptor 15(Gpr15) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF1B-244HCL | Recombinant Human EIF1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR15 Products
Required fields are marked with *
My Review for All GPR15 Products
Required fields are marked with *
