Recombinant Full Length Human GPR3 Protein
| Cat.No. : | GPR3-5510HF | 
| Product Overview : | Human GPR3 full-length ORF (NP_005272.1) recombinant protein without tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Protein Length : | 269 amino acids | 
| Description : | This gene is a member of the G protein-coupled receptor family and is found in the cell membrane. G protein-coupled receptors, characterized by a seven transmembrane domain motif, are involved in translating outside signals into G protein mediated intracellular effects. The encoded protein activates adenylate cyclase and modulates amyloid-beta production in a mouse model, suggesting that it may play a role in Alzheimer's disease. [provided by RefSeq, Oct 2012] | 
| Form : | Liquid | 
| Molecular Mass : | 35 kDa | 
| AA Sequence : | MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV | 
| Applications : | Antibody Production Functional Study Compound Screening | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. | 
| Gene Name | GPR3 G protein-coupled receptor 3 [ Homo sapiens ] | 
| Official Symbol | GPR3 | 
| Synonyms | GPR3; G protein-coupled receptor 3; G-protein coupled receptor 3; ACCA; ACCA orphan receptor; adenylate cyclase constitutive activator; | 
| Gene ID | 2827 | 
| mRNA Refseq | NM_005281 | 
| Protein Refseq | NP_005272 | 
| MIM | 600241 | 
| UniProt ID | P46089 | 
| ◆ Recombinant Proteins | ||
| GPR3-2665R | Recombinant Rat GPR3 Protein | +Inquiry | 
| GPR3-5228H | Recombinant Human GPR3 Protein | +Inquiry | 
| GPR3-5229H | Recombinant Human GPR3 Protein, GST-tagged | +Inquiry | 
| GPR3-13471H | Recombinant Human GPR3, GST-tagged | +Inquiry | 
| GPR3-2319R | Recombinant Rat GPR3 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GPR3-745HCL | Recombinant Human GPR3 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR3 Products
Required fields are marked with *
My Review for All GPR3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            