Recombinant Full Length Human GPR3 Protein, GST-tagged
Cat.No. : | GPR3-5512HF |
Product Overview : | Human GPR3 full-length ORF ( AAH32702, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 330 amino acids |
Description : | This gene is a member of the G protein-coupled receptor family and is found in the cell membrane. G protein-coupled receptors, characterized by a seven transmembrane domain motif, are involved in translating outside signals into G protein mediated intracellular effects. The encoded protein activates adenylate cyclase and modulates amyloid-beta production in a mouse model, suggesting that it may play a role in Alzheimer's disease. [provided by RefSeq, Oct 2012] |
Molecular Mass : | 62.04 kDa |
AA Sequence : | MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR3 G protein-coupled receptor 3 [ Homo sapiens ] |
Official Symbol | GPR3 |
Synonyms | GPR3; G protein-coupled receptor 3; G-protein coupled receptor 3; ACCA; ACCA orphan receptor; adenylate cyclase constitutive activator; |
Gene ID | 2827 |
mRNA Refseq | NM_005281 |
Protein Refseq | NP_005272 |
MIM | 600241 |
UniProt ID | P46089 |
◆ Recombinant Proteins | ||
GPR3-3875M | Recombinant Mouse GPR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR3-13471H | Recombinant Human GPR3, GST-tagged | +Inquiry |
GPR3-2665R | Recombinant Rat GPR3 Protein | +Inquiry |
RFL29889HF | Recombinant Full Length Human G-Protein Coupled Receptor 3(Gpr3) Protein, His-Tagged | +Inquiry |
GPR3-2319R | Recombinant Rat GPR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR3-745HCL | Recombinant Human GPR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR3 Products
Required fields are marked with *
My Review for All GPR3 Products
Required fields are marked with *
0
Inquiry Basket