Recombinant Full Length Human GPR3 Protein, GST-tagged
| Cat.No. : | GPR3-5512HF |
| Product Overview : | Human GPR3 full-length ORF ( AAH32702, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 330 amino acids |
| Description : | This gene is a member of the G protein-coupled receptor family and is found in the cell membrane. G protein-coupled receptors, characterized by a seven transmembrane domain motif, are involved in translating outside signals into G protein mediated intracellular effects. The encoded protein activates adenylate cyclase and modulates amyloid-beta production in a mouse model, suggesting that it may play a role in Alzheimer's disease. [provided by RefSeq, Oct 2012] |
| Molecular Mass : | 62.04 kDa |
| AA Sequence : | MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPR3 G protein-coupled receptor 3 [ Homo sapiens ] |
| Official Symbol | GPR3 |
| Synonyms | GPR3; G protein-coupled receptor 3; G-protein coupled receptor 3; ACCA; ACCA orphan receptor; adenylate cyclase constitutive activator; |
| Gene ID | 2827 |
| mRNA Refseq | NM_005281 |
| Protein Refseq | NP_005272 |
| MIM | 600241 |
| UniProt ID | P46089 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR3 Products
Required fields are marked with *
My Review for All GPR3 Products
Required fields are marked with *



