Recombinant Full Length Human GPR31 Protein
| Cat.No. : | GPR31-5533HF |
| Product Overview : | Human GPR31 full-length ORF (NP_005290.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 525 amino acids |
| Description : | GPR31 (G Protein-Coupled Receptor 31) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Signaling by GPCR. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is HCAR3. |
| Form : | Liquid |
| Molecular Mass : | 35.1 kDa |
| AA Sequence : | MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALRFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GPR31 G protein-coupled receptor 31 [ Homo sapiens ] |
| Official Symbol | GPR31 |
| Synonyms | GPR31; G protein-coupled receptor 31; 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor; 12 (S) HETE acid receptor; 12 HETER; HETER1; hydroxyeicosatetraenoic (HETE) acid receptor 1; 12-(S)-HETE receptor; 12-(S)-HETE acid receptor; G-protein coupled receptor 31; probable G-protein coupled receptor 31; bA517H2.2 (G protein-coupled receptor 31); 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (HETE) receptor; HETER; 12-HETER; |
| Gene ID | 2853 |
| mRNA Refseq | NM_005299 |
| Protein Refseq | NP_005290 |
| MIM | 602043 |
| UniProt ID | O00270 |
| ◆ Cell & Tissue Lysates | ||
| GPR31-5788HCL | Recombinant Human GPR31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR31 Products
Required fields are marked with *
My Review for All GPR31 Products
Required fields are marked with *



