Recombinant Human GPR31 Protein, GST-tagged
Cat.No. : | GPR31-5232H |
Product Overview : | Human GPR31 full-length ORF ( NP_005290.1, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GPR31 (G Protein-Coupled Receptor 31) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Signaling by GPCR. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is HCAR3. |
Molecular Mass : | 61.5 kDa |
AA Sequence : | MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALRFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR31 G protein-coupled receptor 31 [ Homo sapiens ] |
Official Symbol | GPR31 |
Synonyms | GPR31; G protein-coupled receptor 31; 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor; 12 (S) HETE acid receptor; 12 HETER; HETER1; hydroxyeicosatetraenoic (HETE) acid receptor 1; 12-(S)-HETE receptor; 12-(S)-HETE acid receptor; G-protein coupled receptor 31; probable G-protein coupled receptor 31; bA517H2.2 (G protein-coupled receptor 31); 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (HETE) receptor; HETER; 12-HETER; |
Gene ID | 2853 |
mRNA Refseq | NM_005299 |
Protein Refseq | NP_005290 |
MIM | 602043 |
UniProt ID | O00270 |
◆ Cell & Tissue Lysates | ||
GPR31-5788HCL | Recombinant Human GPR31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR31 Products
Required fields are marked with *
My Review for All GPR31 Products
Required fields are marked with *