Recombinant Human GPR31 Protein, GST-tagged

Cat.No. : GPR31-5232H
Product Overview : Human GPR31 full-length ORF ( NP_005290.1, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GPR31 (G Protein-Coupled Receptor 31) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Signaling by GPCR. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is HCAR3.
Molecular Mass : 61.5 kDa
AA Sequence : MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALRFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPR31 G protein-coupled receptor 31 [ Homo sapiens ]
Official Symbol GPR31
Synonyms GPR31; G protein-coupled receptor 31; 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor; 12 (S) HETE acid receptor; 12 HETER; HETER1; hydroxyeicosatetraenoic (HETE) acid receptor 1; 12-(S)-HETE receptor; 12-(S)-HETE acid receptor; G-protein coupled receptor 31; probable G-protein coupled receptor 31; bA517H2.2 (G protein-coupled receptor 31); 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (HETE) receptor; HETER; 12-HETER;
Gene ID 2853
mRNA Refseq NM_005299
Protein Refseq NP_005290
MIM 602043
UniProt ID O00270

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR31 Products

Required fields are marked with *

My Review for All GPR31 Products

Required fields are marked with *

0
cart-icon
0
compare icon