Recombinant Full Length Human GPRC5A Protein
| Cat.No. : | GPRC5A-5534HF |
| Product Overview : | Human GPRC5A full-length ORF (NP_003970.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 370 amino acids |
| Description : | This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq |
| Form : | Liquid |
| Molecular Mass : | 40.3 kDa |
| AA Sequence : | MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GPRC5A G protein-coupled receptor, family C, group 5, member A [ Homo sapiens ] |
| Official Symbol | GPRC5A |
| Synonyms | GPRC5A; G protein-coupled receptor, family C, group 5, member A; GPCR5A, RAI3, retinoic acid induced 3; retinoic acid-induced protein 3; RAIG1; RAIG-1; retinoic acid induced 3; retinoic acid responsive; retinoic acid-induced gene 1 protein; orphan G-protein-coupling receptor PEIG-1; G-protein coupled receptor family C group 5 member A; RAI3; GPCR5A; |
| Gene ID | 9052 |
| mRNA Refseq | NM_003979 |
| Protein Refseq | NP_003970 |
| MIM | 604138 |
| UniProt ID | Q8NFJ5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPRC5A Products
Required fields are marked with *
My Review for All GPRC5A Products
Required fields are marked with *



