Recombinant Full Length Human GPT2 Protein, C-Flag-tagged
Cat.No. : | GPT2-1258HFL |
Product Overview : | Recombinant Full Length Human GPT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a mitochondrial alanine transaminase, a pyridoxal enzyme that catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate. Alanine transaminases play roles in gluconeogenesis and amino acid metabolism in many tissues including skeletal muscle, kidney, and liver. Activating transcription factor 4 upregulates this gene under metabolic stress conditions in hepatocyte cell lines. A loss of function mutation in this gene has been associated with developmental encephalopathy. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.7 kDa |
AA Sequence : | MQRAAALVRRGCGPRTPSSWGRSQSSAAAEASAVLKVRPERSRRERILTLESMNPQVKAVEYAVRGPIVL KAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQ ACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVM IPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRK CIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYR GGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLT EDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGT YHFRMTILPPVEKLKTVLQKVKDFHINFLEKYASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Alanine, aspartate and glutamate metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | GPT2 glutamic--pyruvic transaminase 2 [ Homo sapiens (human) ] |
Official Symbol | GPT2 |
Synonyms | ALT2; GPT 2; MRT49; NEDSPM |
Gene ID | 84706 |
mRNA Refseq | NM_133443.4 |
Protein Refseq | NP_597700.1 |
MIM | 138210 |
UniProt ID | Q8TD30 |
◆ Recombinant Proteins | ||
GPT2-5305H | Recombinant Human GPT2 Protein, GST-tagged | +Inquiry |
Gpt2-381M | Recombinant Mouse Gpt2 Protein, MYC/DDK-tagged | +Inquiry |
GPT2-1258HFL | Recombinant Full Length Human GPT2 Protein, C-Flag-tagged | +Inquiry |
RFL27282SF | Recombinant Full Length Saccharomyces Cerevisiae Glycerol-3-Phosphate O-Acyltransferase 2(Gpt2) Protein, His-Tagged | +Inquiry |
GPT2-7214H | Recombinant Human GPT2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPT2-720RCL | Recombinant Rat GPT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPT2 Products
Required fields are marked with *
My Review for All GPT2 Products
Required fields are marked with *
0
Inquiry Basket