Recombinant Full Length Human GPX5 Protein, GST-tagged

Cat.No. : GPX5-5583HF
Product Overview : Human GPX5 full-length ORF ( NP_003987.2, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 100 amino acids
Description : This gene belongs to the glutathione peroxidase family. It is specifically expressed in the epididymis in the mammalian male reproductive tract, and is androgen-regulated. Unlike mRNAs for other characterized glutathione peroxidases, this mRNA does not contain a selenocysteine (UGA) codon. Thus, the encoded protein is selenium-independent, and has been proposed to play a role in protecting the membranes of spermatozoa from the damaging effects of lipid peroxidation and/or preventing premature acrosome reaction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Molecular Mass : 37.8 kDa
AA Sequence : MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPX5 glutathione peroxidase 5 (epididymal androgen-related protein) [ Homo sapiens ]
Official Symbol GPX5
Synonyms GPX5; glutathione peroxidase 5 (epididymal androgen-related protein); epididymal secretory glutathione peroxidase; EGLP; GPx-5; GSHPx-5; epididymal androgen-related protein; epididymis-specific glutathione peroxidase-like protein;
Gene ID 2880
mRNA Refseq NM_001509
Protein Refseq NP_001500
MIM 603435
UniProt ID O75715

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPX5 Products

Required fields are marked with *

My Review for All GPX5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon