Recombinant Full Length Human Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha(Csf2Ra) Protein, His-Tagged
Cat.No. : | RFL16988HF |
Product Overview : | Recombinant Full Length Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA) Protein (P15509) (23-400aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-400) |
Form : | Lyophilized powder |
AA Sequence : | EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CSF2RA |
Synonyms | CD_antigen=CD116; CD116; CD116 antigen; CDw116; Colony stimulating factor 2 receptor alpha chain; Colony stimulating factor 2 receptor alpha low affinity; Colony stimulating factor 2 receptor alpha subunit; CSF 2R; CSF2R; CSF2R_HUMAN; CSF2RA; CSF2RAX; CSF |
UniProt ID | P15509 |
◆ Recombinant Proteins | ||
CSF2RA-1530H | Active Recombinant Human CSF2RA protein(Met1-Gly320), hFc-tagged | +Inquiry |
CSF2RA-497H | Recombinant Human CSF2RA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSF2RA-1970H | Recombinant Human CSF2RA Protein | +Inquiry |
CSF2RA-7035H | Recombinant Human CSF2RA protein, His & GST-tagged | +Inquiry |
CSF2RA-509H | Recombinant Human CSF2RA protein, His-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CSF2RA-34H | Active Recombinant Human CSF2RA Homodimer Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2RA-2713HCL | Recombinant Human CSF2RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF2RA Products
Required fields are marked with *
My Review for All CSF2RA Products
Required fields are marked with *