Recombinant Full Length Human GRK2 Protein, C-Flag-tagged
Cat.No. : | GRK2-1271HFL |
Product Overview : | Recombinant Full Length Human GRK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal, mitochondrial, and transcription factor proteins. Data from rodent models supports a role for this gene in embryonic development, heart function and metabolism. Elevated expression of this gene has been observed in human patients with heart failure and Alzheimer's disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 79.4 kDa |
AA Sequence : | MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRD FCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLACSHPFSKSATEHVQGHLGKKQ VPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRK ADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLH YHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHAS VGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDE EDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCI MHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQF ILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGLSGPSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Chemokine signaling pathway, Endocytosis |
Full Length : | Full L. |
Gene Name | GRK2 G protein-coupled receptor kinase 2 [ Homo sapiens (human) ] |
Official Symbol | GRK2 |
Synonyms | BARK1; ADRBK1; BETA-ARK1 |
Gene ID | 156 |
mRNA Refseq | NM_001619.5 |
Protein Refseq | NP_001610.2 |
MIM | 109635 |
UniProt ID | P25098 |
◆ Recombinant Proteins | ||
GRK2-1177H | Recombinant Human GRK2 Protein (2-221 aa), His-tagged | +Inquiry |
GRK2-1271HFL | Recombinant Full Length Human GRK2 Protein, C-Flag-tagged | +Inquiry |
Grk2-467M | Recombinant Mouse Grk2 Protein, MYC/DDK-tagged | +Inquiry |
GRK2-1021H | Recombinant Human GRK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Grk2-4286M | Recombinant Mouse Grk2 protein, His-B2M-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRK2 Products
Required fields are marked with *
My Review for All GRK2 Products
Required fields are marked with *