Recombinant Full Length Human GRK2 Protein, C-Flag-tagged
| Cat.No. : | GRK2-1271HFL |
| Product Overview : | Recombinant Full Length Human GRK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal, mitochondrial, and transcription factor proteins. Data from rodent models supports a role for this gene in embryonic development, heart function and metabolism. Elevated expression of this gene has been observed in human patients with heart failure and Alzheimer's disease. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 79.4 kDa |
| AA Sequence : | MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRD FCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLACSHPFSKSATEHVQGHLGKKQ VPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRK ADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLH YHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHAS VGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDE EDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCI MHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQF ILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGLSGPSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Protein Kinase |
| Protein Pathways : | Chemokine signaling pathway, Endocytosis |
| Full Length : | Full L. |
| Gene Name | GRK2 G protein-coupled receptor kinase 2 [ Homo sapiens (human) ] |
| Official Symbol | GRK2 |
| Synonyms | BARK1; ADRBK1; BETA-ARK1 |
| Gene ID | 156 |
| mRNA Refseq | NM_001619.5 |
| Protein Refseq | NP_001610.2 |
| MIM | 109635 |
| UniProt ID | P25098 |
| ◆ Recombinant Proteins | ||
| GRK2-386H | Recombinant Human GRK2 Protein, His/GST-tagged | +Inquiry |
| GRK2-1177H | Recombinant Human GRK2 Protein (2-221 aa), His-tagged | +Inquiry |
| GRK2-72HFL | Active Recombinant Full Length Human GRK2 Protein, N-His-tagged | +Inquiry |
| Grk2-4286M | Recombinant Mouse Grk2 protein, His-B2M-tagged | +Inquiry |
| GRK2-1920M | Recombinant Mouse GRK2 Protein (1-689 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRK2 Products
Required fields are marked with *
My Review for All GRK2 Products
Required fields are marked with *
