Recombinant Full Length Human GRPEL1 Protein, GST-tagged

Cat.No. : GRPEL1-5604HF
Product Overview : Human GRPEL1 full-length ORF ( NP_079472.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 217 amino acids
Description : GRPEL1 (GrpE Like 1, Mitochondrial) is a Protein Coding gene. Diseases associated with GRPEL1 include Human Monocytic Ehrlichiosis and Ehrlichiosis. Among its related pathways are Metabolism of proteins and Mitochondrial protein import. GO annotations related to this gene include protein homodimerization activity and chaperone binding. An important paralog of this gene is GRPEL2.
Molecular Mass : 50.7 kDa
AA Sequence : MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRPEL1 GrpE-like 1, mitochondrial (E. coli) [ Homo sapiens ]
Official Symbol GRPEL1
Synonyms GRPEL1; GrpE-like 1, mitochondrial (E. coli); grpE protein homolog 1, mitochondrial; FLJ25609; HMGE; mt-GrpE#1; GrpE-like protein cochaperone;
Gene ID 80273
mRNA Refseq NM_025196
Protein Refseq NP_079472
MIM 606173
UniProt ID Q9HAV7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRPEL1 Products

Required fields are marked with *

My Review for All GRPEL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon