Recombinant Full Length Human GSDMA Protein, GST-tagged

• Cat.No.: GSDMA-3324HF
• Product Overview: Human GSDMA full-length ORF (BAC04790.1, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 445 amino acids
• Description: GSDMA (Gasdermin A) is a Protein Coding gene. Diseases associated with GSDMA include Retinitis Pigmentosa 23. An important paralog of this gene is GSDMC.
• Molecular Mass: 75.8 kDa
• AA Sequence: MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETLQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQLMVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSHLQQLTKAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GSDMA gasdermin A [ Homo sapiens ]
• Official Symbol: GSDMA
• Synonyms: GSDMA; gasdermin A; gasdermin , gasdermin 1 , GSDM, GSDM1; gasdermin-A; FLJ39120; gasdermin 1; gasdermin-1; GSDM; FKSG9; GSDM1; MGC129596
• Gene ID: 284110
• mRNA Refseq: NM_178171
• Protein Refseq: NP_835465
• MIM: 611218
• UniProt ID: Q96QA5