Recombinant Full Length Human GSDMA Protein, GST-tagged

Cat.No. : GSDMA-3324HF
Product Overview : Human GSDMA full-length ORF (BAC04790.1, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 445 amino acids
Description : GSDMA (Gasdermin A) is a Protein Coding gene. Diseases associated with GSDMA include Retinitis Pigmentosa 23. An important paralog of this gene is GSDMC.
Molecular Mass : 75.8 kDa
AA Sequence : MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETLQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQLMVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSHLQQLTKAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GSDMA gasdermin A [ Homo sapiens ]
Official Symbol GSDMA
Synonyms GSDMA; gasdermin A; gasdermin , gasdermin 1 , GSDM, GSDM1; gasdermin-A; FLJ39120; gasdermin 1; gasdermin-1; GSDM; FKSG9; GSDM1; MGC129596;
Gene ID 284110
mRNA Refseq NM_178171
Protein Refseq NP_835465
MIM 611218
UniProt ID Q96QA5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSDMA Products

Required fields are marked with *

My Review for All GSDMA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon