Recombinant Full Length Human GSTA2 Protein, GST-tagged

Cat.No. : GSTA2-3335HF
Product Overview : Human GSTA2 full-length ORF ( NP_000837.2, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 222 amino acids
Description : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq
Molecular Mass : 52.1 kDa
AA Sequence : MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GSTA2 glutathione S-transferase alpha 2 [ Homo sapiens ]
Official Symbol GSTA2
Synonyms GSTA2; glutathione S-transferase alpha 2; glutathione S transferase A2 , GST2; glutathione S-transferase A2; GST-gamma; liver GST2; GST HA subunit 2; GST class-alpha member 2; glutathione S-aryltransferase A2; glutathione S-alkyltransferase A2; glutathione S-aralkyltransferase A2; S-(hydroxyalkyl)glutathione lyase A2; GST2; GTA2; GTH2; GSTA2-2; MGC10525;
Gene ID 2939
mRNA Refseq NM_000846
Protein Refseq NP_000837
MIM 138360
UniProt ID P09210

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTA2 Products

Required fields are marked with *

My Review for All GSTA2 Products

Required fields are marked with *

0
cart-icon