Recombinant Full Length Human GSTA2 Protein, GST-tagged
| Cat.No. : | GSTA2-3335HF |
| Product Overview : | Human GSTA2 full-length ORF ( NP_000837.2, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 222 amino acids |
| Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq |
| Molecular Mass : | 52.1 kDa |
| AA Sequence : | MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GSTA2 glutathione S-transferase alpha 2 [ Homo sapiens ] |
| Official Symbol | GSTA2 |
| Synonyms | GSTA2; glutathione S-transferase alpha 2; glutathione S transferase A2 , GST2; glutathione S-transferase A2; GST-gamma; liver GST2; GST HA subunit 2; GST class-alpha member 2; glutathione S-aryltransferase A2; glutathione S-alkyltransferase A2; glutathione S-aralkyltransferase A2; S-(hydroxyalkyl)glutathione lyase A2; GST2; GTA2; GTH2; GSTA2-2; MGC10525; |
| Gene ID | 2939 |
| mRNA Refseq | NM_000846 |
| Protein Refseq | NP_000837 |
| MIM | 138360 |
| UniProt ID | P09210 |
| ◆ Recombinant Proteins | ||
| GSTA2-1666HFL | Recombinant Full Length Human GSTA2 Protein, C-Flag-tagged | +Inquiry |
| GSTA2-13570H | Recombinant Human GSTA2 protein, GST-tagged | +Inquiry |
| GSTA2-7325M | Recombinant Mouse GSTA2 Protein | +Inquiry |
| GSTA2-3967M | Recombinant Mouse GSTA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GSTA2-1029H | Recombinant Human GSTA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTA2-5718HCL | Recombinant Human GSTA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTA2 Products
Required fields are marked with *
My Review for All GSTA2 Products
Required fields are marked with *
