Recombinant Full Length Human GSTA4 Protein
| Cat.No. : | GSTA4-213HF |
| Product Overview : | Recombinant full length Human GSTA4 with N terminal proprietary tag. Predicted MW 50.16 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 222 amino acids |
| Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinsons disease, Alzheimers disease, cataract formation, and atherosclerosis. |
| Form : | Liquid |
| Molecular Mass : | 50.160kDa inclusive of tags |
| AA Sequence : | MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQ LYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHN LFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE VVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVIL LQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEP GSKKKPPPDEIYVRTVYNIFRP |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | GSTA4 glutathione S-transferase alpha 4 [ Homo sapiens ] |
| Official Symbol | GSTA4 |
| Synonyms | GSTA4; glutathione S-transferase alpha 4; glutathione S transferase A4; glutathione S-transferase A4 |
| Gene ID | 2941 |
| mRNA Refseq | NM_001512 |
| Protein Refseq | NP_001503 |
| MIM | 605450 |
| UniProt ID | O15217 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTA4 Products
Required fields are marked with *
My Review for All GSTA4 Products
Required fields are marked with *
