Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Join NIH Research Festival Biotech Vendor Exhibits 2024 | Sep. 25th, 2024

Recombinant Full Length Human GSTA4 Protein

Cat.No. : GSTA4-213HF
Product Overview : Recombinant full length Human GSTA4 with N terminal proprietary tag. Predicted MW 50.16 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinsons disease, Alzheimers disease, cataract formation, and atherosclerosis.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 50.160kDa inclusive of tags
Protein length : 222 amino acids
AA Sequence : MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQ LYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHN LFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE VVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVIL LQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEP GSKKKPPPDEIYVRTVYNIFRP
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : GSTA4 glutathione S-transferase alpha 4 [ Homo sapiens ]
Official Symbol : GSTA4
Synonyms : GSTA4; glutathione S-transferase alpha 4; glutathione S transferase A4; glutathione S-transferase A4
Gene ID : 2941
mRNA Refseq : NM_001512
Protein Refseq : NP_001503
MIM : 605450
UniProt ID : O15217

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GSTA4 Products

Required fields are marked with *

My Review for All GSTA4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends