Recombinant Full Length Human GSTK1 Protein, GST-tagged
Cat.No. : | GSTK1-3346HF |
Product Overview : | Human GSTK1 full-length ORF ( AAH01231.1, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 226 amino acids |
Description : | This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants |
Molecular Mass : | 50.60 kDa |
AA Sequence : | MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSTK1 glutathione S-transferase kappa 1 [ Homo sapiens ] |
Official Symbol | GSTK1 |
Synonyms | GSTK1; glutathione S-transferase kappa 1; GST13; GST class-kappa; glutathione S-transferase k1; glutathione S-transferase subunit 13 homolog; GST; hGSTK1; GSTK1-1; GST13-13; GST 13-13; |
Gene ID | 373156 |
mRNA Refseq | NM_001143679 |
Protein Refseq | NP_001137151 |
MIM | 602321 |
UniProt ID | Q9Y2Q3 |
◆ Recombinant Proteins | ||
GSTK1-29087TH | Recombinant Human GSTK1 | +Inquiry |
GSTK1-4414H | Recombinant Human GSTK1 Protein, GST-tagged | +Inquiry |
GSTK1-1162H | Recombinant Human GSTK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GSTK1-2780H | Recombinant Human GSTK1 Protein (Thr7-Val222), N-His tagged | +Inquiry |
GSTK1-1489H | Recombinant Human GSTK1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTK1-5714HCL | Recombinant Human GSTK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTK1 Products
Required fields are marked with *
My Review for All GSTK1 Products
Required fields are marked with *
0
Inquiry Basket