Recombinant Full Length Human GSTM5 Protein
Cat.No. : | GSTM5-217HF |
Product Overview : | Recombinant full length Human GSTM5 with a N terminal proprietary tag: predicted molecular weight 50.05 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 50.050kDa inclusive of tags |
Protein Length : | 218 amino acids |
AA Sequence : | MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPD YDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYI ARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDF EKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLA YDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKS SQFLRGLLFGKSATWNSK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | GSTM5 glutathione S-transferase mu 5 [ Homo sapiens ] |
Official Symbol : | GSTM5 |
Synonyms : | GSTM5; glutathione S-transferase mu 5; glutathione S transferase M5; glutathione S-transferase Mu 5 |
Gene ID : | 2949 |
mRNA Refseq : | NM_000851 |
Protein Refseq : | NP_000842 |
MIM : | 138385 |
UniProt ID : | P46439 |
Products Types
◆ Recombinant Protein | ||
GSTM5-324C | Recombinant Cynomolgus Monkey GSTM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTM5-3975M | Recombinant Mouse GSTM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTM5-2460H | Recombinant Human GSTM5 Protein, MYC/DDK-tagged | +Inquiry |
GSTM5-2387R | Recombinant Rat GSTM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTM5-25H | Active Recombinant Human GSTM5 protein, His-tagged | +Inquiry |
◆ Lysates | ||
GSTM5-760HCL | Recombinant Human GSTM5 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket