Recombinant Full Length Human GSTM5 Protein

Cat.No. : GSTM5-217HF
Product Overview : Recombinant full length Human GSTM5 with a N terminal proprietary tag: predicted molecular weight 50.05 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 218 amino acids
Description : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds.
Form : Liquid
Molecular Mass : 50.050kDa inclusive of tags
AA Sequence : MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPD YDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYI ARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDF EKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLA YDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKS SQFLRGLLFGKSATWNSK
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name GSTM5 glutathione S-transferase mu 5 [ Homo sapiens ]
Official Symbol GSTM5
Synonyms GSTM5; glutathione S-transferase mu 5; glutathione S transferase M5; glutathione S-transferase Mu 5
Gene ID 2949
mRNA Refseq NM_000851
Protein Refseq NP_000842
MIM 138385
UniProt ID P46439

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTM5 Products

Required fields are marked with *

My Review for All GSTM5 Products

Required fields are marked with *

0
cart-icon