Recombinant Full Length Human GSTT1 Protein, GST-tagged
| Cat.No. : | GSTT1-3368HF |
| Product Overview : | Human GSTT1 full-length ORF ( AAH07065, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 240 amino acids |
| Description : | Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis. The GSTT1 gene is located approximately 50kb away from the GSTT2 gene. The GSTT1 and GSTT2 genes have a similar structure, being composed of five exons with identical exon/intron boundaries. [provided by RefSeq |
| Molecular Mass : | 52.14 kDa |
| AA Sequence : | MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GSTT1 glutathione S-transferase theta 1 [ Homo sapiens ] |
| Official Symbol | GSTT1 |
| Synonyms | GSTT1; glutathione S-transferase theta 1; glutathione S-transferase theta-1; GST class-theta-1; glutathione transferase T1-1; |
| Gene ID | 2952 |
| mRNA Refseq | NM_000853 |
| Protein Refseq | NP_000844 |
| MIM | 600436 |
| UniProt ID | P30711 |
| ◆ Recombinant Proteins | ||
| GSTT1-2223H | Recombinant Human GSTT1 Protein, His-tagged | +Inquiry |
| GSTT1-180H | Recombinant Human Glutathione S-transferase Theta 1, His-tagged | +Inquiry |
| Gstt1-618R | Recombinant Rat Gstt1 protein, His & T7-tagged | +Inquiry |
| GSTT1-13582H | Recombinant Human GSTT1, His-tagged | +Inquiry |
| GSTT1-3368HF | Recombinant Full Length Human GSTT1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTT1-312HCL | Recombinant Human GSTT1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTT1 Products
Required fields are marked with *
My Review for All GSTT1 Products
Required fields are marked with *
