Recombinant Full Length Human GSTT2 Protein, GST-tagged
| Cat.No. : | GSTT2-3369HF | 
| Product Overview : | Human GSTT2 full-length ORF ( AAH02415, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 244 amino acids | 
| Description : | Glutathione S-transferase (GSTs) theta 2 (GSTT2) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: Alpha, Mu, Pi, Theta, and Zeta. The theta class members GSTT1 and GSTT2 share 55% amino acid sequence identity and both are thought to have an important role in human carcinogenesis. The theta genes have a similar structure, being composed of five exons with identical exon/intron boundaries. [provided by RefSeq | 
| Molecular Mass : | 52.58 kDa | 
| AA Sequence : | MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | GSTT2 glutathione S-transferase theta 2 [ Homo sapiens ] | 
| Official Symbol | GSTT2 | 
| Synonyms | GSTT2; glutathione S-transferase theta 2; glutathione S-transferase theta-2; GST class-theta-2; Glutathione S-transferase theta-2B; GSTT2B; MGC182032; | 
| Gene ID | 2953 | 
| mRNA Refseq | NM_000854 | 
| Protein Refseq | NP_000845 | 
| MIM | 600437 | 
| UniProt ID | P0CG29 | 
| ◆ Recombinant Proteins | ||
| GSTT2-3982M | Recombinant Mouse GSTT2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| GSTT2-581C | Recombinant Cynomolgus GSTT2 Protein, His-tagged | +Inquiry | 
| GSTT2-3369HF | Recombinant Full Length Human GSTT2 Protein, GST-tagged | +Inquiry | 
| Gstt2-2667R | Recombinant Rat Gstt2 protein, His & T7-tagged | +Inquiry | 
| GSTT2-7342M | Recombinant Mouse GSTT2 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GSTT2-5708HCL | Recombinant Human GSTT2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All GSTT2 Products
Required fields are marked with *
My Review for All GSTT2 Products
Required fields are marked with *
  
        
    
      
            