Recombinant Full Length Human GTF2H5 Protein, GST-tagged

Cat.No. : GTF2H5-3398HF
Product Overview : Human GTF2H5 full-length ORF ( NP_997001.1, 1 a.a. - 71 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 71 amino acids
Description : This gene encodes a subunit of transcription/repair factor TFIIH, which functions in gene transcription and DNA repair. This protein stimulates ERCC3/XPB ATPase activity to trigger DNA opening during DNA repair, and is implicated in regulating cellular levels of TFIIH. Mutations in this gene result in trichothiodystrophy, complementation group A. [provided by RefSeq, Mar 2009]
Molecular Mass : 34.5 kDa
AA Sequence : MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTF2H5 general transcription factor IIH subunit 5 [ Homo sapiens (human) ]
Official Symbol GTF2H5
Synonyms GTF2H5; general transcription factor IIH subunit 5; TTD; TFB5; TTD3; TTDA; TFIIH; TTD-A; TGF2H5; C6orf175; bA120J8.2; general transcription factor IIH subunit 5; TFB5 ortholog; TFIIH basal transcription factor complex TTD-A subunit; TFIIH basal transcription factor complex TTDA subunit; general transcription factor IIH, polypeptide 5; General Transcription Factor IIH Subunit 5; TFIIH Basal Transcription Factor Complex TTD-A Subunit; General Transcription Factor IIH, Polypeptide 5; TFB5 Ortholog; TFIIH Basal Transcription Factor Complex TTDA Subunit; DNA Repair Syndrome Trichothiodystrophy Group A; General Transcription Factor IIH Polypeptide 5; Chromosome 6 Open Reading Frame 175
Gene ID 404672
mRNA Refseq NM_207118
Protein Refseq NP_997001
MIM 608780
UniProt ID Q6ZYL4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTF2H5 Products

Required fields are marked with *

My Review for All GTF2H5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon