Recombinant Full Length Human GTPBP1 Protein, GST-tagged
| Cat.No. : | GTPBP1-3421HF |
| Product Overview : | Human GTPBP1 full-length ORF ( ENSP00000334787, 1 a.a. - 584 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 584 amino acids |
| Description : | This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype. [provided by RefSeq |
| Molecular Mass : | 89.8 kDa |
| AA Sequence : | MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKGPLTKRDEGGPSGGPAVGAPPPGDEASSVGAGQPAASSNLQPQPKPSSGGRRRGGQRHKVKSQGACVTPASGC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GTPBP1 GTP binding protein 1 [ Homo sapiens ] |
| Official Symbol | GTPBP1 |
| Synonyms | GTPBP1; GTP binding protein 1; GTP-binding protein 1; GP 1; HSPC018; G-protein 1; GP1; GP-1; MGC20069; |
| Gene ID | 9567 |
| mRNA Refseq | NM_004286 |
| Protein Refseq | NP_004277 |
| MIM | 602245 |
| UniProt ID | O00178 |
| ◆ Recombinant Proteins | ||
| GTPBP1-2403R | Recombinant Rat GTPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GTPBP1-3999M | Recombinant Mouse GTPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GTPBP1-2749R | Recombinant Rat GTPBP1 Protein | +Inquiry |
| Gtpbp1-1074M | Recombinant Mouse Gtpbp1 Protein, MYC/DDK-tagged | +Inquiry |
| GTPBP1-1835R | Recombinant Rhesus Macaque GTPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GTPBP1-5687HCL | Recombinant Human GTPBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTPBP1 Products
Required fields are marked with *
My Review for All GTPBP1 Products
Required fields are marked with *
