Recombinant Full Length Human GTPBP5 Protein, GST-tagged
Cat.No. : | GTPBP5-3426HF |
Product Overview : | Human GTPBP5 full-length ORF ( NP_056481.1, 1 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 406 amino acids |
Description : | Small G proteins, such as GTPBP5, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM |
Molecular Mass : | 70.4 kDa |
AA Sequence : | MAPARCFSARLRTVFQGVGHWALSTWAGLKPSRLLPQRASPRLLSVGRADLAKHQELPGKKLLSEKKLKRYFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQPGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIPGIIRGAHQNRGLGSAFLRHIERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLPEAQANLSQLRDHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GTPBP5 GTP binding protein 5 (putative) [ Homo sapiens ] |
Official Symbol | GTPBP5 |
Synonyms | GTPBP5; GTP binding protein 5 (putative); GTP-binding protein 5; dJ1005F21.2; FLJ10741; ObgH1; protein obg homolog 1; GTP-binding protein 5 (putative); MGC29512; |
Gene ID | 26164 |
mRNA Refseq | NM_015666 |
Protein Refseq | NP_056481 |
MIM | 610919 |
UniProt ID | Q9H4K7 |
◆ Recombinant Proteins | ||
GTPBP5-3426HF | Recombinant Full Length Human GTPBP5 Protein, GST-tagged | +Inquiry |
GTPBP5-1837R | Recombinant Rhesus Macaque GTPBP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GTPBP5-4475H | Recombinant Human GTPBP5 Protein, GST-tagged | +Inquiry |
GTPBP5-13610H | Recombinant Human GTPBP5, GST-tagged | +Inquiry |
GTPBP5-2016R | Recombinant Rhesus monkey GTPBP5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTPBP5-5683HCL | Recombinant Human GTPBP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTPBP5 Products
Required fields are marked with *
My Review for All GTPBP5 Products
Required fields are marked with *