Recombinant Human GTPBP5 Protein, GST-tagged

Cat.No. : GTPBP5-4475H
Product Overview : Human GTPBP5 full-length ORF ( NP_056481.1, 1 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Small G proteins, such as GTPBP5, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM
Molecular Mass : 70.4 kDa
AA Sequence : MAPARCFSARLRTVFQGVGHWALSTWAGLKPSRLLPQRASPRLLSVGRADLAKHQELPGKKLLSEKKLKRYFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQPGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIPGIIRGAHQNRGLGSAFLRHIERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLPEAQANLSQLRDHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTPBP5 GTP binding protein 5 (putative) [ Homo sapiens ]
Official Symbol GTPBP5
Synonyms GTPBP5; GTP binding protein 5 (putative); GTP-binding protein 5; dJ1005F21.2; FLJ10741; ObgH1; protein obg homolog 1; GTP-binding protein 5 (putative); MGC29512;
Gene ID 26164
mRNA Refseq NM_015666
Protein Refseq NP_056481
MIM 610919
UniProt ID Q9H4K7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTPBP5 Products

Required fields are marked with *

My Review for All GTPBP5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon