Recombinant Full Length Human GXYLT1 Protein, GST-tagged

Cat.No. : GXYLT1-5355HF
Product Overview : Human GLT8D3 full-length ORF ( AAH39145.1, 1 a.a. - 409 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 409 amino acids
Description : GXYLT1 is a xylosyltransferase (EC 2.4.2.-) that adds the first xylose to O-glucose-modified residues in the epidermal growth factor (EGF; MIM 131530) repeats of proteins such as NOTCH1 (MIM 190198) (Sethi et al., 2010 [PubMed 19940119]).[supplied by OMIM, Mar 2010]
Molecular Mass : 73.2 kDa
AA Sequence : MRRYLRVVVLCVACGFCSLLYAFSQLAVSLEEGTGGGGGKPQAAVASWLAGGGRGAVRGAGVAGPAAHPGVSDRYSLKIQPVEKMHLAVVACGERLEETMTMLKSAIIFSIKPLQFHIFAEDQLHHSFKGRLDNWSFLQTFNYTLYPITFPSENAAEWKKLFKPCASQRLFLPLILKEVDSLLYVDTDILFLRPVDDIWSLLKKFNSTQIAAMAPEHEEPRIGWYNRFARHPYYGKTGVNSGVMLMNMTRMRRKYFKNDMTTVRLQWGDILMPLLKKYKLNITWGDQDLLNIVFFHNPESLFVFPCQWNYRPDHCIYGSNCQEAEEGGIFILHGNRGVYHDDKQPAFRAVYEALRNCSFEDDNIRSLLKPLELELQKTVHTYCGKIYKIFIKQLAKSVRDRYARSPKEK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GXYLT1 glucoside xylosyltransferase 1 [ Homo sapiens (human) ]
Official Symbol GXYLT1
Synonyms GXYLT1; glucoside xylosyltransferase 1; GLT8D3; glucoside xylosyltransferase 1; glycosyltransferase 8 domain containing 3; glycosyltransferase 8 domain-containing protein 3; NP_001093120.1; EC 2.4.2.n2
Gene ID 283464
mRNA Refseq NM_001099650
Protein Refseq NP_001093120
MIM 613321
UniProt ID Q4G148

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GXYLT1 Products

Required fields are marked with *

My Review for All GXYLT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon