Recombinant Full Length Human H1F0 Protein, GST-tagged
| Cat.No. : | H1F0-3395HF |
| Product Overview : | Human H1F0 full-length ORF ( NP_005309.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 194 amino acids |
| Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H1 family. [provided by RefSeq |
| Molecular Mass : | 47.3 kDa |
| AA Sequence : | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | H1F0 H1 histone family, member 0 [ Homo sapiens ] |
| Official Symbol | H1F0 |
| Synonyms | H1F0; H1 histone family, member 0; H1FV; histone H1.0; H1.0; H1(0); H1 0; H10; histone H1; histone H1(0); H1.0, H1(0), H1-0; MGC5241; |
| Gene ID | 3005 |
| mRNA Refseq | NM_005318 |
| Protein Refseq | NP_005309 |
| MIM | 142708 |
| UniProt ID | P07305 |
| ◆ Recombinant Proteins | ||
| H1F0-4528H | Recombinant Human H1F0 Protein, GST-tagged | +Inquiry |
| H1F0-2132H | Recombinant Human H1 Histone Family, Member 0 | +Inquiry |
| H1F0-7420M | Recombinant Mouse H1F0 Protein | +Inquiry |
| H1F0-100H | Recombinant Human H1F0 Protein | +Inquiry |
| H1F0-9956Z | Recombinant Zebrafish H1F0 | +Inquiry |
| ◆ Native Proteins | ||
| H1F0-01B | Native Bovine H1F0 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| H1F0-2117HCL | Recombinant Human H1F0 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H1F0 Products
Required fields are marked with *
My Review for All H1F0 Products
Required fields are marked with *



