Recombinant Full Length Human HAPLN2 Protein, GST-tagged
| Cat.No. : | HAPLN2-3356HF |
| Product Overview : | Human HAPLN2 full-length ORF (BAG52217.1, 1 a.a. - 340 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 599 amino acids |
| Description : | HAPLN2 (Hyaluronan And Proteoglycan Link Protein 2) is a Protein Coding gene. Among its related pathways are Phospholipase-C Pathway and ERK Signaling. GO annotations related to this gene include extracellular matrix structural constituent and hyaluronic acid binding. An important paralog of this gene is HAPLN3. |
| Molecular Mass : | 64.2 kDa |
| AA Sequence : | MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HAPLN2 hyaluronan and proteoglycan link protein 2 [ Homo sapiens ] |
| Official Symbol | HAPLN2 |
| Synonyms | BRAL1 |
| Gene ID | 60484 |
| mRNA Refseq | NM_021817 |
| Protein Refseq | NP_068589 |
| MIM | 619726 |
| UniProt ID | Q9GZV7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAPLN2 Products
Required fields are marked with *
My Review for All HAPLN2 Products
Required fields are marked with *
