Recombinant Full Length Human HBXIP Protein, GST-tagged
Cat.No. : | HBXIP-3501HF |
Product Overview : | Human HBXIP full-length ORF ( AAH62619, 83 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 173 amino acids |
Description : | This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq |
Molecular Mass : | 35.75 kDa |
AA Sequence : | MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAAHKMAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HBXIP hepatitis B virus x interacting protein [ Homo sapiens ] |
Official Symbol | HBXIP |
Synonyms | HBXIP; hepatitis B virus x interacting protein; hepatitis B virus X-interacting protein; HBx interacting protein; hepatitis B virus x interacting protein (9.6kD); MGC71071; XIP; HBx-interacting protein; HBV X-interacting protein; hepatitis B virus x-interacting protein (9.6kD); |
Gene ID | 10542 |
mRNA Refseq | NM_006402 |
Protein Refseq | NP_006393 |
MIM | 608521 |
UniProt ID | O43504 |
◆ Recombinant Proteins | ||
HBXIP-6961H | Recombinant Human Hepatitis B Virus X Interacting Protein, His-tagged | +Inquiry |
HBXIP-13689H | Recombinant Human HBXIP, GST-tagged | +Inquiry |
HBXIP-3501HF | Recombinant Full Length Human HBXIP Protein, GST-tagged | +Inquiry |
HBXIP-3022H | Recombinant Human HBXIP protein, GST-tagged | +Inquiry |
HBXIP-4063C | Recombinant Chicken HBXIP | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBXIP-5616HCL | Recombinant Human HBXIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HBXIP Products
Required fields are marked with *
My Review for All HBXIP Products
Required fields are marked with *
0
Inquiry Basket