Recombinant Full Length Human HBXIP Protein, GST-tagged

Cat.No. : HBXIP-3501HF
Product Overview : Human HBXIP full-length ORF ( AAH62619, 83 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 173 amino acids
Description : This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq
Molecular Mass : 35.75 kDa
AA Sequence : MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAAHKMAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HBXIP hepatitis B virus x interacting protein [ Homo sapiens ]
Official Symbol HBXIP
Synonyms HBXIP; hepatitis B virus x interacting protein; hepatitis B virus X-interacting protein; HBx interacting protein; hepatitis B virus x interacting protein (9.6kD); MGC71071; XIP; HBx-interacting protein; HBV X-interacting protein; hepatitis B virus x-interacting protein (9.6kD);
Gene ID 10542
mRNA Refseq NM_006402
Protein Refseq NP_006393
MIM 608521
UniProt ID O43504

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBXIP Products

Required fields are marked with *

My Review for All HBXIP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon