Recombinant Full Length Human HBXIP Protein, GST-tagged

• Cat.No.: HBXIP-3501HF
• Product Overview: Human HBXIP full-length ORF ( AAH62619, 83 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 173 amino acids
• Description: This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq
• Molecular Mass: 35.75 kDa
• AA Sequence: MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAAHKMAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HBXIP hepatitis B virus x interacting protein [ Homo sapiens ]
• Official Symbol: HBXIP
• Synonyms: HBXIP; hepatitis B virus x interacting protein; hepatitis B virus X-interacting protein; HBx interacting protein; hepatitis B virus x interacting protein (9.6kD); MGC71071; XIP; HBx-interacting protein; HBV X-interacting protein; hepatitis B virus x-interacting protein (9.6kD)
• Gene ID: 10542
• mRNA Refseq: NM_006402
• Protein Refseq: NP_006393
• MIM: 608521
• UniProt ID: O43504