Recombinant Full Length Human HDHD3 Protein, GST-tagged
Cat.No. : | HDHD3-3444HF |
Product Overview : | Human HDHD3 full-length ORF ( NP_112496.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 251 amino acids |
Description : | HDHD3 (Haloacid Dehalogenase Like Hydrolase Domain Containing 3) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity. |
Molecular Mass : | 54.4 kDa |
AA Sequence : | MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HDHD3 haloacid dehalogenase-like hydrolase domain containing 3 [ Homo sapiens ] |
Official Symbol | HDHD3 |
Synonyms | HDHD3; haloacid dehalogenase-like hydrolase domain containing 3; C9orf158, chromosome 9 open reading frame 158; haloacid dehalogenase-like hydrolase domain-containing protein 3; MGC12904; C9orf158; 2810435D12Rik; |
Gene ID | 81932 |
mRNA Refseq | NM_031219 |
Protein Refseq | NP_112496 |
UniProt ID | Q9BSH5 |
◆ Recombinant Proteins | ||
HDHD3-4665H | Recombinant Human HDHD3 Protein, GST-tagged | +Inquiry |
HDHD3-1879R | Recombinant Rhesus Macaque HDHD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HDHD3-2058R | Recombinant Rhesus monkey HDHD3 Protein, His-tagged | +Inquiry |
HDHD3-961H | Recombinant Human HDHD3, His-tagged | +Inquiry |
HDHD3-6231H | Recombinant Human HDHD3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDHD3-5594HCL | Recombinant Human HDHD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HDHD3 Products
Required fields are marked with *
My Review for All HDHD3 Products
Required fields are marked with *
0
Inquiry Basket