Recombinant Full Length Human HDHD3 Protein, GST-tagged
| Cat.No. : | HDHD3-3444HF |
| Product Overview : | Human HDHD3 full-length ORF ( NP_112496.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 251 amino acids |
| Description : | HDHD3 (Haloacid Dehalogenase Like Hydrolase Domain Containing 3) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity. |
| Molecular Mass : | 54.4 kDa |
| AA Sequence : | MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HDHD3 haloacid dehalogenase-like hydrolase domain containing 3 [ Homo sapiens ] |
| Official Symbol | HDHD3 |
| Synonyms | HDHD3; haloacid dehalogenase-like hydrolase domain containing 3; C9orf158, chromosome 9 open reading frame 158; haloacid dehalogenase-like hydrolase domain-containing protein 3; MGC12904; C9orf158; 2810435D12Rik; |
| Gene ID | 81932 |
| mRNA Refseq | NM_031219 |
| Protein Refseq | NP_112496 |
| UniProt ID | Q9BSH5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDHD3 Products
Required fields are marked with *
My Review for All HDHD3 Products
Required fields are marked with *
