Recombinant Full Length Human HEBP1 Protein, GST-tagged

Cat.No. : HEBP1-3455HF
Product Overview : Human HEBP1 full-length ORF ( AAH16277.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 189 amino acids
Description : The full-length protein encoded by this gene is an intracellular tetrapyrrole-binding protein. This protein includes a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and promotes calcium mobilization and chemotaxis in monocytes and dendritic cells. [provided by RefSeq
Molecular Mass : 47.5 kDa
AA Sequence : MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HEBP1 heme binding protein 1 [ Homo sapiens ]
Official Symbol HEBP1
Synonyms HEBP1; heme binding protein 1; heme-binding protein 1; HBP; HEBP; p22HBP;
Gene ID 50865
mRNA Refseq NM_015987
Protein Refseq NP_057071
MIM 605826
UniProt ID Q9NRV9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HEBP1 Products

Required fields are marked with *

My Review for All HEBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon