Recombinant Full Length Human HECTD3 Protein, GST-tagged

Cat.No. : HECTD3-3461HF
Product Overview : Human HECTD3 full-length ORF ( AAH19105.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 210 amino acids
Description : The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8. [provided by RefSeq, Dec 2012]
Molecular Mass : 50.4 kDa
AA Sequence : MEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNFTNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEEKLRYAAYNCVAIDTDMSPWEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HECTD3 HECT domain containing E3 ubiquitin protein ligase 3 [ Homo sapiens ]
Official Symbol HECTD3
Synonyms HECTD3; HECT domain containing E3 ubiquitin protein ligase 3; HECT domain containing 3; E3 ubiquitin-protein ligase HECTD3; FLJ21156; HECT domain-containing protein 3; probable E3 ubiquitin-protein ligase HECTD3; RP11-69J16.1; FLJ31983; MGC161630;
Gene ID 79654
mRNA Refseq NM_024602
Protein Refseq NP_078878
MIM 618638
UniProt ID Q5T447

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HECTD3 Products

Required fields are marked with *

My Review for All HECTD3 Products

Required fields are marked with *

0
cart-icon
0
compare icon