Recombinant Full Length Human HELLS Protein
Cat.No. : | HELLS-224HF |
Product Overview : | Recombinant full length Human SMARCA6 with N-terminal proprietary tag. Predicted MW 64.39kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 64.390kDa inclusive of tags |
Protein Length : | 348 amino acids |
AA Sequence : | MFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEK LISQIQPEVDRERAVVEVNIPVESEVNLKLQNIMMLLRKC CNHPYLIEYPIDPVTQEFKIDEELVTNSGKFLILDRMLPE LKKRGHKVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMS YSEREKNMHSFNTDPEVFIFLVSTRAGGLGINLTAADTVI IYDSDWNPQSDLQAQDRCHRIGQTKPVVVYRLVTANTIDQ KIVERAAAKRKLEKLIIHKNHFKGGQSGLNLSKNFLDPKE LMELLKSRDYEREIKGSREKVISDKDLELLLDRSDLIDQM NASGPIKEKMGIFKILENSEDSSPECLF |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | HELLS helicase, lymphoid-specific [ Homo sapiens ] |
Official Symbol : | HELLS |
Synonyms : | HELLS; helicase, lymphoid-specific; lymphoid-specific helicase; LSH; Nbla10143; PASG; proliferation associated SNF2 like protein; SMARCA6; SWI/SNF2 related; matrix associated; actin dependent regulator of chromatin; subfamily A; member 6 |
Gene ID : | 3070 |
mRNA Refseq : | NM_018063 |
Protein Refseq : | NP_060533 |
MIM : | 603946 |
UniProt ID : | Q9NRZ9 |
Products Types
◆ Recombinant Protein | ||
Hells-1109M | Recombinant Mouse Hells Protein, MYC/DDK-tagged | +Inquiry |
HELLS-1885R | Recombinant Rhesus Macaque HELLS Protein, His (Fc)-Avi-tagged | +Inquiry |
HELLS-4117M | Recombinant Mouse HELLS Protein, His (Fc)-Avi-tagged | +Inquiry |
HELLS-4683H | Recombinant Human HELLS Protein, GST-tagged | +Inquiry |
HELLS-3472Z | Recombinant Zebrafish HELLS | +Inquiry |
◆ Lysates | ||
HELLS-5589HCL | Recombinant Human HELLS 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket