Recombinant Full Length Human HEMGN Protein, GST-tagged

Cat.No. : HEMGN-3475HF
Product Overview : Human HEMGN full-length ORF ( NP_060907.2, 1 a.a. - 484 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 484 amino acids
Description : HEMGN (Hemogen) is a Protein Coding gene. Diseases associated with HEMGN include Isolated Cleft Lip.
Molecular Mass : 81.7 kDa
AA Sequence : MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGKGNRRGRKRQQNTELKVEPQPQIEKEIVEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQESNIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEPEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSEDYSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKECFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HEMGN hemogen [ Homo sapiens ]
Official Symbol HEMGN
Synonyms HEMGN; hemogen; EDAG; hemopoietic gene protein; negative differentiation regulator protein; erythroid differentiation-associated gene protein; EDAG-1;
Gene ID 55363
mRNA Refseq NM_018437
Protein Refseq NP_060907
MIM 610715
UniProt ID Q9BXL5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HEMGN Products

Required fields are marked with *

My Review for All HEMGN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon