Recombinant Full Length Human Hepacam Family Member 2(Hepacam2) Protein, His-Tagged
Cat.No. : | RFL9752HF |
Product Overview : | Recombinant Full Length Human HEPACAM family member 2(HEPACAM2) Protein (A8MVW5) (32-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (32-462) |
Form : | Lyophilized powder |
AA Sequence : | LKVTVPSHTVHGVRGQALYLPVHYGFHTPASDIQIIWLFERPHTMPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNYIVKVNIQGNGTLSASQKIQVTVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTRLAYQWLKNGRPVHTSSTYSFSPQNNTLHIAPVTKEDIGNYSCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSHPPNTYSWIRRTDNTTYIIKHGPRLEVASEKVAQKTMDYVCCAYNNITGRQDETHFTVIITSVGLEKLAQKGKSLSPLASITGISLFLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQTFSGHEDALDDFGIYEFVAFPDVSGVSRIPSRSVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HEPACAM2 |
Synonyms | HEPACAM2; MIKI; UNQ305/PRO346; HEPACAM family member 2; Mitotic kinetics regulator |
UniProt ID | A8MVW5 |
◆ Recombinant Proteins | ||
RFL5724BF | Recombinant Full Length Bovine Hepacam Family Member 2(Hepacam2) Protein, His-Tagged | +Inquiry |
HEPACAM2-1094H | Recombinant Human HEPACAM2 Protein, MYC/DDK-tagged | +Inquiry |
HEPACAM2-2348R | Recombinant Rat HEPACAM2 protein(Met1-Leu350), hFc-tagged | +Inquiry |
HEPACAM2-7576M | Recombinant Mouse HEPACAM2 Protein | +Inquiry |
Hepacam2-19R | Recombinant Rat Hepacam2, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEPACAM2-1385RCL | Recombinant Rat HEPACAM2 cell lysate | +Inquiry |
HEPACAM2-1050RCL | Recombinant Rat HEPACAM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HEPACAM2 Products
Required fields are marked with *
My Review for All HEPACAM2 Products
Required fields are marked with *
0
Inquiry Basket