Recombinant Full Length Human Herpesvirus 1 Envelope Glycoprotein E(Ge) Protein, His-Tagged
Cat.No. : | RFL18408HF |
Product Overview : | Recombinant Full Length Human herpesvirus 1 Envelope glycoprotein E(gE) Protein (P04488) (21-550aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human Herpesvirus 1 |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (21-550) |
Form : | Lyophilized powder |
AA Sequence : | GTPKTSWRRVSVGEDVSLLPAPGPTGRGPTQKLLWAVEPLDGCGPLHPSWVSLMPPKQVP ETVVDAACMRAPVPLAMAYAPPAPSATGGLRTDFVWQERAAVVNRSLVIHGVRETDSGLY TLSVGDIKDPARQVASVVLVVQPAPVPTPPPTPADYDEDDNDEGEDESLAGTPASGTPRL PPPPAPPRSWPSAPEVSHVRGVTVRMETPEAILFSPGETFSTNVSIHAIAHDDQTYSMDV VWLRFDVPTSCAEMRIYESCLYHPQLPECLSPADAPCAASTWTSRLAVRSYAGCSRTNPP PRCSAEAHMEPVPGLAWQAASVNLEFRDASPQHSGLYLCVVYVNDHIHAWGHITISTAAQ YRNAVVEQPLPQRGADLAEPTHPHVGAPPHAPPTHGALRLGAVMGAALLLSALGLSVWAC MTCWRRRAWRAVKSRASGKGPTYIRVADSELYADWSSDSEGERDQVPWLAPPERPDSPST NGSGFEILSPTAPSVYPRSDGHQSRRQLTTFGSGRPDRRYSQASDSSVFW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gE |
Synonyms | gE; US8; Envelope glycoprotein E; gE; gE-1 |
UniProt ID | P04488 |
◆ Recombinant Proteins | ||
gE-4533S | Recombinant Suid herpesvirus 1 (strain Rice) gE protein, His-tagged | +Inquiry |
gE-1461H | Recombinant HHV-3 gE Full Length Transmembrane protein, His-SUMO-tagged | +Inquiry |
gE-2430H | Recombinant HHV-3 gE protein, His-SUMO-tagged | +Inquiry |
gE-1701H | Recombinant HSV-2 gE Protein, His tagged | +Inquiry |
gE-262V | Recombinant Encephalitis gE Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gE Products
Required fields are marked with *
My Review for All gE Products
Required fields are marked with *
0
Inquiry Basket