Recombinant Full Length Human Herv-H Ltr-Associating Protein 2(Hhla2) Protein, His-Tagged
Cat.No. : | RFL13259HF |
Product Overview : | Recombinant Full Length Human HERV-H LTR-associating protein 2(HHLA2) Protein (Q9UM44) (23-414aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-414) |
Form : | Lyophilized powder |
AA Sequence : | IFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLE SQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFL TPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNIT GSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSR MKSGTFSVLAYYLSSSQNTIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSD EYTLLTIHTVHVEPSQETASHNKGLWILVPSAILAAFLLIWSVKCCRAQLEARRSRHPAD GAQQERCCVPPGERCPSAPDNGEENVPLSGKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HHLA2 |
Synonyms | HHLA2; HERV-H LTR-associating protein 2; Human endogenous retrovirus-H long terminal repeat-associating protein 2 |
UniProt ID | Q9UM44 |
◆ Recombinant Proteins | ||
HHLA2-548H | Recombinant Human HHLA2 protein, Fc-tagged | +Inquiry |
HHLA2-1523R | Recombinant Rhesus Monkey HHLA2 Protein, hIgG1-tagged | +Inquiry |
HHLA2-2898C | Active Recombinant Cynomolgus HHLA2 protein, His-tagged | +Inquiry |
HHLA2-421H | Active Recombinant Human HHLA2 protein, Fc-tagged | +Inquiry |
HHLA2-2148H | Active Recombinant Human HHLA2 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HHLA2-5569HCL | Recombinant Human HHLA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HHLA2 Products
Required fields are marked with *
My Review for All HHLA2 Products
Required fields are marked with *
0
Inquiry Basket