Recombinant Full Length Human HES2 Protein, GST-tagged

Cat.No. : HES2-3516HF
Product Overview : Human HES2 full-length ORF ( ENSP00000164269, 1 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 76 amino acids
Description : HES2 (Hes Family BHLH Transcription Factor 2) is a Protein Coding gene. GO annotations related to this gene include transcription factor binding and double-stranded DNA binding. An important paralog of this gene is HES1.
Molecular Mass : 35 kDa
AA Sequence : MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGREDASGWHTWLPLHAQNCFLLYIQAPEQPPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HES2 hairy and enhancer of split 2 (Drosophila) [ Homo sapiens ]
Official Symbol HES2
Synonyms HES2; hairy and enhancer of split 2 (Drosophila); transcription factor HES-2; bHLHb40; class B basic helix-loop-helix protein 40;
Gene ID 54626
mRNA Refseq NM_019089
Protein Refseq NP_061962
MIM 609970
UniProt ID Q9Y543

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HES2 Products

Required fields are marked with *

My Review for All HES2 Products

Required fields are marked with *

0
cart-icon