Recombinant Full Length Human HES2 Protein, GST-tagged
Cat.No. : | HES2-3516HF |
Product Overview : | Human HES2 full-length ORF ( ENSP00000164269, 1 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 76 amino acids |
Description : | HES2 (Hes Family BHLH Transcription Factor 2) is a Protein Coding gene. GO annotations related to this gene include transcription factor binding and double-stranded DNA binding. An important paralog of this gene is HES1. |
Molecular Mass : | 35 kDa |
AA Sequence : | MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGREDASGWHTWLPLHAQNCFLLYIQAPEQPPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HES2 hairy and enhancer of split 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | HES2 |
Synonyms | HES2; hairy and enhancer of split 2 (Drosophila); transcription factor HES-2; bHLHb40; class B basic helix-loop-helix protein 40; |
Gene ID | 54626 |
mRNA Refseq | NM_019089 |
Protein Refseq | NP_061962 |
MIM | 609970 |
UniProt ID | Q9Y543 |
◆ Recombinant Proteins | ||
HES2-15904H | Recombinant Human HES2, His-tagged | +Inquiry |
HES2-7587M | Recombinant Mouse HES2 Protein | +Inquiry |
HES2-1092H | Recombinant Human HES2 Protein, MYC/DDK-tagged | +Inquiry |
HES2-2830R | Recombinant Rat HES2 Protein | +Inquiry |
HES2-3516HF | Recombinant Full Length Human HES2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HES2-320HCL | Recombinant Human HES2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HES2 Products
Required fields are marked with *
My Review for All HES2 Products
Required fields are marked with *