Recombinant Full Length Human HES7 Protein, GST-tagged
Cat.No. : | HES7-3521HF |
Product Overview : | Human HES7 full-length ORF ( NP_115969.2, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 225 amino acids |
Description : | This gene encodes a member of the hairy and enhancer of split family of bHLH transcription factors. The mouse ortholog of this gene is regulated by Notch signaling. The protein functions as a transcriptional repressor, and is implicated in correct patterning of the axial skeleton. A mutation in this gene has been shown to result in spondylocostal dysostosis. Multiple transcript variants encoding different isoforms have been found for this gene |
Molecular Mass : | 51.15 kDa |
AA Sequence : | MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFSALHGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPVHQGHPSPRCAWSPSLCSPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPLPPPPAFWRPWP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HES7 hairy and enhancer of split 7 (Drosophila) [ Homo sapiens ] |
Official Symbol | HES7 |
Synonyms | HES7; hairy and enhancer of split 7 (Drosophila); transcription factor HES-7; bHLH factor Hes7; bHLHb37; hHes7; class B basic helix-loop-helix protein 37; SCDO4; |
Gene ID | 84667 |
mRNA Refseq | NM_001165967 |
Protein Refseq | NP_001159439 |
MIM | 608059 |
UniProt ID | Q9BYE0 |
◆ Recombinant Proteins | ||
HES7-399H | Recombinant Human hes family bHLH transcription factor 7, His-tagged | +Inquiry |
HES7-4707H | Recombinant Human HES7 Protein, GST-tagged | +Inquiry |
HES7-4136M | Recombinant Mouse HES7 Protein, His (Fc)-Avi-tagged | +Inquiry |
HES7-7591M | Recombinant Mouse HES7 Protein | +Inquiry |
HES7-3521HF | Recombinant Full Length Human HES7 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HES7 Products
Required fields are marked with *
My Review for All HES7 Products
Required fields are marked with *