Recombinant Full Length Human HES7 Protein, GST-tagged

Cat.No. : HES7-3521HF
Product Overview : Human HES7 full-length ORF ( NP_115969.2, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 225 amino acids
Description : This gene encodes a member of the hairy and enhancer of split family of bHLH transcription factors. The mouse ortholog of this gene is regulated by Notch signaling. The protein functions as a transcriptional repressor, and is implicated in correct patterning of the axial skeleton. A mutation in this gene has been shown to result in spondylocostal dysostosis. Multiple transcript variants encoding different isoforms have been found for this gene
Molecular Mass : 51.15 kDa
AA Sequence : MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFSALHGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPVHQGHPSPRCAWSPSLCSPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPLPPPPAFWRPWP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HES7 hairy and enhancer of split 7 (Drosophila) [ Homo sapiens ]
Official Symbol HES7
Synonyms HES7; hairy and enhancer of split 7 (Drosophila); transcription factor HES-7; bHLH factor Hes7; bHLHb37; hHes7; class B basic helix-loop-helix protein 37; SCDO4;
Gene ID 84667
mRNA Refseq NM_001165967
Protein Refseq NP_001159439
MIM 608059
UniProt ID Q9BYE0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HES7 Products

Required fields are marked with *

My Review for All HES7 Products

Required fields are marked with *

0
cart-icon
0
compare icon