Recombinant Full Length Human HEXIM2 Protein, C-Flag-tagged
Cat.No. : | HEXIM2-2162HFL |
Product Overview : | Recombinant Full Length Human HEXIM2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the HEXIM family of proteins. This protein is a component of the 7SK small nuclear ribonucleoprotein. This protein has been found to negatively regulate the kinase activity of the cyclin-dependent kinase P-TEFb, which phosphorylates multiple target proteins to promote transcriptional elongation. This gene is located approximately 7 kb downstream from related family member HEXIM1 on chromosome 17. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSR SPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAP YNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSK QELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRC DEEPGT myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | HEXIM2 HEXIM P-TEFb complex subunit 2 [ Homo sapiens (human) ] |
Official Symbol | HEXIM2 |
Synonyms | L3 |
Gene ID | 124790 |
mRNA Refseq | NM_144608.2 |
Protein Refseq | NP_653209.1 |
MIM | 615695 |
UniProt ID | Q96MH2 |
◆ Recombinant Proteins | ||
HEXIM2-2072R | Recombinant Rhesus monkey HEXIM2 Protein, His-tagged | +Inquiry |
Hexim2-3388M | Recombinant Mouse Hexim2 Protein, Myc/DDK-tagged | +Inquiry |
HEXIM2-2162HFL | Recombinant Full Length Human HEXIM2 Protein, C-Flag-tagged | +Inquiry |
HEXIM2-1089H | Recombinant Human HEXIM2 Protein, MYC/DDK-tagged | +Inquiry |
HEXIM2-1064H | Recombinant Human HEXIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HEXIM2 Products
Required fields are marked with *
My Review for All HEXIM2 Products
Required fields are marked with *
0
Inquiry Basket