Recombinant Full Length Human HIBADH Protein, GST-tagged
| Cat.No. : | HIBADH-3463HF |
| Product Overview : | Human HIBADH full-length ORF ( NP_689953.1, 1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 336 amino acids |
| Description : | 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM |
| Molecular Mass : | 61.7 kDa |
| AA Sequence : | MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HIBADH 3-hydroxyisobutyrate dehydrogenase [ Homo sapiens ] |
| Official Symbol | HIBADH |
| Synonyms | HIBADH; 3-hydroxyisobutyrate dehydrogenase; 3-hydroxyisobutyrate dehydrogenase, mitochondrial; NS5ATP1; MGC40361; |
| Gene ID | 11112 |
| mRNA Refseq | NM_152740 |
| Protein Refseq | NP_689953 |
| MIM | 608475 |
| UniProt ID | P31937 |
| ◆ Recombinant Proteins | ||
| HIBADH-1506C | Recombinant Chicken HIBADH | +Inquiry |
| HIBADH-2839R | Recombinant Rat HIBADH Protein | +Inquiry |
| Hibadh-3391M | Recombinant Mouse Hibadh Protein, Myc/DDK-tagged | +Inquiry |
| HIBADH-7618M | Recombinant Mouse HIBADH Protein | +Inquiry |
| HIBADH-2494R | Recombinant Rat HIBADH Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HIBADH-785HCL | Recombinant Human HIBADH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIBADH Products
Required fields are marked with *
My Review for All HIBADH Products
Required fields are marked with *
