Recombinant Full Length Human HINT1 Protein, GST-tagged

Cat.No. : HINT1-3469HF
Product Overview : Human HINT1 full-length ORF ( AAH01287, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 126 amino acids
Description : This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed. [provided by RefSeq, Dec 2015]
Molecular Mass : 39.6 kDa
AA Sequence : MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HINT1 histidine triad nucleotide binding protein 1 [ Homo sapiens ]
Official Symbol HINT1
Synonyms HINT1; histidine triad nucleotide binding protein 1; HINT, histidine triad nucleotide binding protein , PRKCNH1; histidine triad nucleotide-binding protein 1; PKCI 1; protein kinase C inhibitor 1; adenosine 5-monophosphoramidase; protein kinase C-interacting protein 1; HINT; PKCI-1; PRKCNH1; FLJ30414; FLJ32340;
Gene ID 3094
mRNA Refseq NM_005340
Protein Refseq NP_005331
MIM 601314
UniProt ID P49773

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HINT1 Products

Required fields are marked with *

My Review for All HINT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon