Recombinant Full Length Human HINT1 Protein, GST-tagged
Cat.No. : | HINT1-3469HF |
Product Overview : | Human HINT1 full-length ORF ( AAH01287, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 126 amino acids |
Description : | This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 39.6 kDa |
AA Sequence : | MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HINT1 histidine triad nucleotide binding protein 1 [ Homo sapiens ] |
Official Symbol | HINT1 |
Synonyms | HINT1; histidine triad nucleotide binding protein 1; HINT, histidine triad nucleotide binding protein , PRKCNH1; histidine triad nucleotide-binding protein 1; PKCI 1; protein kinase C inhibitor 1; adenosine 5-monophosphoramidase; protein kinase C-interacting protein 1; HINT; PKCI-1; PRKCNH1; FLJ30414; FLJ32340; |
Gene ID | 3094 |
mRNA Refseq | NM_005340 |
Protein Refseq | NP_005331 |
MIM | 601314 |
UniProt ID | P49773 |
◆ Recombinant Proteins | ||
HINT1-4750H | Recombinant Human HINT1 Protein, GST-tagged | +Inquiry |
HINT1-2081R | Recombinant Rhesus monkey HINT1 Protein, His-tagged | +Inquiry |
HINT1-4397H | Recombinant Human Histidine Triad Nucleotide Binding Protein 1 | +Inquiry |
Hint1-1126M | Recombinant Mouse Hint1 Protein, MYC/DDK-tagged | +Inquiry |
HINT1-238H | Recombinant Human HINT1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HINT1-5558HCL | Recombinant Human HINT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HINT1 Products
Required fields are marked with *
My Review for All HINT1 Products
Required fields are marked with *