Recombinant Full Length Human HIST1H1D Protein, GST-tagged

Cat.No. : HIST1H1D-3565HF
Product Overview : Human HIST1H1D full-length ORF (BAG35698.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 221 amino acids
Description : Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq
Molecular Mass : 50.71 kDa
AA Sequence : MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIST1H1D histone cluster 1, H1d [ Homo sapiens ]
Official Symbol HIST1H1D
Synonyms HIST1H1D; histone cluster 1, H1d; H1 histone family, member 3 , H1F3, histone 1, H1d; histone H1.3; H1.3; H1d; H1s 2; histone H1c; histone 1, H1d; H1 histone family, member 3; H1D; H1F3; MGC138176;
Gene ID 3007
mRNA Refseq NM_005320
Protein Refseq NP_005311
MIM 142210
UniProt ID P16402

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIST1H1D Products

Required fields are marked with *

My Review for All HIST1H1D Products

Required fields are marked with *

0
cart-icon