Recombinant Full Length Human HIST1H1E Protein, GST-tagged
| Cat.No. : | HIST1H1E-3566HF |
| Product Overview : | Human HIST1H1E full-length ORF (BAG36431.1, 1 a.a. - 219 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 219 amino acids |
| Description : | Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq |
| Molecular Mass : | 50.49 kDa |
| AA Sequence : | MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGAAKKPKKVTGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAKPKKAPKSPAKAKAVKPKAAKPKTAKPKAAKPKKAAAKKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HIST1H1E histone cluster 1, H1e [ Homo sapiens ] |
| Official Symbol | HIST1H1E |
| Synonyms | HIST1H1E; histone cluster 1, H1e; H1 histone family, member 4 , H1F4, histone 1, H1e; histone H1.4; H1.4; H1e; H1s 4; histone H1b; histone 1, H1e; H1 histone family, member 4; H1E; H1F4; dJ221C16.5; MGC116819; |
| Gene ID | 3008 |
| mRNA Refseq | NM_005321 |
| Protein Refseq | NP_005312 |
| MIM | 142220 |
| UniProt ID | P10412 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIST1H1E Products
Required fields are marked with *
My Review for All HIST1H1E Products
Required fields are marked with *
