Recombinant Full Length Human HIST1H2BN Protein, GST-tagged
Cat.No. : | HIST1H2BN-3586HF |
Product Overview : | Human HIST1H2BN full-length ORF ( AAH11372, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 166 amino acids |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2B family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq |
Molecular Mass : | 44.00 kDa |
AA Sequence : | MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKKRKRRFTESIKKAHGFRKLKIWLKLRVSNQSPDDIYIARD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIST1H2BN histone cluster 1, H2bn [ Homo sapiens ] |
Official Symbol | HIST1H2BN |
Synonyms | histone cluster 1, H2bn; 4749; Ensembl:ENSG00000233822; MGC9388, MGC125414, MGC125415, MGC125416; histone H2B type 1-N;histone H2B.d;histone 1, H2bn;H2B histone family, member D; H2B/d; H2BFD |
Gene ID | 8341 |
mRNA Refseq | NM_003520 |
Protein Refseq | NP_003511 |
MIM | 602801 |
UniProt ID | Q99877 |
◆ Recombinant Proteins | ||
HIST1H2BN-7672M | Recombinant Mouse HIST1H2BN Protein | +Inquiry |
HIST1H2BN-13796H | Recombinant Human HIST1H2BN, GST-tagged | +Inquiry |
HIST1H2BN-4793H | Recombinant Human HIST1H2BN Protein, GST-tagged | +Inquiry |
HIST1H2BN-4197M | Recombinant Mouse HIST1H2BN Protein, His (Fc)-Avi-tagged | +Inquiry |
HIST1H2BN-3586HF | Recombinant Full Length Human HIST1H2BN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H2BN-5534HCL | Recombinant Human HIST1H2BN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIST1H2BN Products
Required fields are marked with *
My Review for All HIST1H2BN Products
Required fields are marked with *