Recombinant Full Length Human HIST3H2A Protein, GST-tagged
Cat.No. : | HIST3H2A-3604HF |
Product Overview : | Human HIST3H2A full-length ORF (BAG34871.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 130 amino acids |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq |
Molecular Mass : | 40.7 kDa |
AA Sequence : | MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIST3H2A histone cluster 3 H2A [ Homo sapiens (human) ] |
Official Symbol | HIST3H2A |
Synonyms | HIST3H2A; histone cluster 3 H2A; histone H2A type 3; histone 3, H2a; histone cluster 3, H2a |
Gene ID | 92815 |
mRNA Refseq | NM_033445 |
Protein Refseq | NP_254280 |
MIM | 615015 |
UniProt ID | Q7L7L0 |
◆ Recombinant Proteins | ||
HIST3H2A-2514R | Recombinant Rat HIST3H2A Protein, His (Fc)-Avi-tagged | +Inquiry |
HIST3H2A-4816H | Recombinant Human HIST3H2A Protein, GST-tagged | +Inquiry |
HIST3H2A-260H | Recombinant Human HIST3H2A protein(Met1-Lys130) | +Inquiry |
HIST3H2A-132H | Recombinant Human HIST3H2A Protein, DDK-tagged | +Inquiry |
HIST3H2A-3604HF | Recombinant Full Length Human HIST3H2A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST3H2A-5513HCL | Recombinant Human HIST3H2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIST3H2A Products
Required fields are marked with *
My Review for All HIST3H2A Products
Required fields are marked with *