Recombinant Full Length Human Histo-Blood Group Abo System Transferase(Abo) Protein, His-Tagged
Cat.No. : | RFL-6616HF |
Product Overview : | Recombinant Full Length Human Histo-blood group ABO system transferase(ABO) Protein (P16442) (1-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-354) |
Form : | Lyophilized powder |
AA Sequence : | MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABO |
Synonyms | ABO; Histo-blood group ABO system transferase; Fucosylglycoprotein 3-alpha-galactosyltransferase; Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; Glycoprotein-fucosylgal |
UniProt ID | P16442 |
◆ Recombinant Proteins | ||
ABO-111H | Recombinant Human ABO Protein, GST-Tagged | +Inquiry |
ABO-26280TH | Recombinant Human ABO Protein, His-tagged | +Inquiry |
ABO-3074H | Recombinant Human ABO protein, His-tagged | +Inquiry |
RFL-25176MF | Recombinant Full Length Mouse Histo-Blood Group Abo System Transferase(Abo) Protein, His-Tagged | +Inquiry |
ABO-1146M | Recombinant Mouse ABO Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABO-9124HCL | Recombinant Human ABO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABO Products
Required fields are marked with *
My Review for All ABO Products
Required fields are marked with *